PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G058900.1.p
Common NameGLYMA_04G058900, LOC100794431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 310aa    MW: 33732.8 Da    PI: 7.3523
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G058900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.27.8e-09446440
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                         + C+ +++  ++l+C+ +  +lC  C ++ H        H +v
  Glyma.04G058900.1.p  4 KLCDSCKSATATLYCRPDAAFLCGACDSKVHAAnklasrHPRV 46
                         68*****************************656666667665 PP

2zf-B_box23.41.3e-074791442
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                           C+ +e+ +++  C+ +   lC  C   +H+       H+++p+
  Glyma.04G058900.1.p 47 ALCEVCEQAPAHVTCKADAAALCLACDRDIHSAnplasrHERIPV 91
                         68*****************************66899999998885 PP

3CCT69.58.7e-24252295144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  Glyma.04G058900.1.p 252 REARVLRYREKRKNRKFEKTIRYASRKAYAEARPRIKGRFAKRT 295
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.665148IPR000315B-box-type zinc finger
SMARTSM003361.1E-13148IPR000315B-box-type zinc finger
PfamPF006433.7E-7446IPR000315B-box-type zinc finger
CDDcd000218.76E-9548No hitNo description
PROSITE profilePS5011910.6374491IPR000315B-box-type zinc finger
PfamPF006433.0E-64791IPR000315B-box-type zinc finger
SMARTSM003362.4E-94991IPR000315B-box-type zinc finger
PfamPF062031.2E-17252294IPR010402CCT domain
PROSITE profilePS5101716.708252294IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MASKLCDSCK SATATLYCRP DAAFLCGACD SKVHAANKLA SRHPRVALCE VCEQAPAHVT  60
CKADAAALCL ACDRDIHSAN PLASRHERIP VSPFFESVHS VKASSPINFL DDHRFFSDAD  120
ADVSTEEAEA ASWLLPNPKT DLNSSQYLFS ETEPVPYIDL DYAAVDPKAE QKSSATADGV  180
VPVQSNFEPF AYGYKYNTTL SQSQMSQSVS SSSMEVGVVP DGNTMSETSN CSYSKVPPVT  240
VTVTAQFSAA DREARVLRYR EKRKNRKFEK TIRYASRKAY AEARPRIKGR FAKRTDPDPL  300
AGYGVVPSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.549110.0cotyledon| flower| hypocotyl| meristem| root| seed coat| somatic embryo| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0933000.0BT093300.1 Soybean clone JCVI-FLGm-17I7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522335.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-111COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLI1JU450.0I1JU45_SOYBN; Uncharacterized protein
STRINGGLYMA04G06240.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-101CONSTANS-like 4